PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006734m
Common NameCARUB_v10006734mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 433aa    MW: 50655.7 Da    PI: 6.7572
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006734mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.23.9e-18222268148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEd +l+++v ++G + W+ Ia+ ++ gR +kqc++rw+++l
  Carubv10006734m 222 KGQWTAEEDRILIQLVDKYGLRKWSHIAQVLP-GRIGKQCRERWHNHL 268
                      799*****************************.*************97 PP

2Myb_DNA-binding521.6e-16274316145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +  W++eEd  l++ +k+ G++ W+ Ia++++ gRt++++k++w+
  Carubv10006734m 274 KETWSEEEDRVLIEFHKEIGNK-WAEIAKRLP-GRTENSIKNHWN 316
                      578*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.352217272IPR017930Myb domain
SuperFamilySSF466893.07E-32220315IPR009057Homeodomain-like
SMARTSM007172.3E-17221270IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-26223273IPR009057Homeodomain-like
CDDcd001674.12E-15225268No hitNo description
PfamPF139213.5E-20225282No hitNo description
PROSITE profilePS5129421.16273323IPR017930Myb domain
SMARTSM007174.8E-16273321IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-22274321IPR009057Homeodomain-like
CDDcd001676.63E-12276319No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010183Biological Processpollen tube guidance
GO:0045697Biological Processregulation of synergid differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MENFVDESGG FVPLNQNIFT RDQEHMKEED FPFEVVDQSK PTSFLQDFHH LDHHHQFDHH  60
HHHHQGSSSS NHLLGLQTTS SCINNAPFEH CSYQENMVEF YESKPHLTMN HHFQAPENPT  120
YFTRNHHHHH HQEINLVDEH EHMDLEQNNM MMMRMIPFDY PPTETVKPMN LVMPDEISCV  180
SADTDCYRAT SFNKTKPYLT RKLSSSSSSS SWKEKKTSTL VKGQWTAEED RILIQLVDKY  240
GLRKWSHIAQ VLPGRIGKQC RERWHNHLRP DIKKETWSEE EDRVLIEFHK EIGNKWAEIA  300
KRLPGRTENS IKNHWNATKR RQFSKRKCRS KYPRPSLLQD YIKSLNLGVL SASSVPARGR  360
RRESNKKKDV VAAVEEKKKD QEEIYGEDRI VPECVFTDDF GFNEKLLEEG CSIDSLLDDI  420
PQPDIDAFVH GI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C6e-452203232105C-Myb DNA-Binding Domain
1msf_C6e-452203232105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00442DAPTransfer from AT4G18770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1980820.0DQ198082.1 Arabidopsis thaliana myb family transcription factor (MYB98) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285344.10.0hypothetical protein CARUB_v10006734mg
SwissprotQ9S7L20.0MYB98_ARATH; Transcription factor MYB98
TrEMBLR0F8H60.0R0F8H6_9BRAS; Uncharacterized protein
STRINGBra013346.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58692847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.10.0myb domain protein 98